2.50 Rating by CuteStat

seaborneairlines.com is 2 decades 4 years old. It is a domain having com extension. It has a global traffic rank of #1528852 in the world. This website is estimated worth of $ 720.00 and have a daily income of around $ 3.00. As no active threats were reported recently by users, seaborneairlines.com is SAFE to browse.

PageSpeed Score
0
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 551
Daily Pageviews: 1,102

Estimated Valuation

Income Per Day: $ 3.00
Estimated Worth: $ 720.00

Search Engine Indexes

Google Indexed Pages: 359
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 1,760,000
Bing Backlinks: 14,100

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 1,528,852
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

107.180.71.200

Hosted Country:

United States of America US

Location Latitude:

33.6013

Location Longitude:

-111.8867
SILVER | SEABORNE - Seaborne Airlines

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 2 H2 Headings: 1
H3 Headings: 3 H4 Headings: 14
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: 1 Total Images: 7
Google Adsense: Not Applicable Google Analytics: UA-36347918-1

Websites Hosted on Same IP (i.e. 107.180.71.200)

Log In ‹ Seaborne Airlines Employee Portal — WordPress

- portal.seaborneairlines.com
1,689,302 $ 720.00

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Fri, 13 Dec 2019 01:01:45 GMT
Server: Apache
Link: <https://www.seaborneairlines.com/wp-json/>; rel="https://api.w.org/", <https://www.seaborneairlines.com/>; rel=shortlink
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: acens Technologies, S.L.U.
Registration Date: Mar 25, 2000, 1:19 AM 2 decades 4 years 4 weeks ago
Expiration Date: Mar 25, 2020, 12:19 AM 4 years 4 weeks 6 days ago
Domain Status:
clienttransferprohibited
clientupdateprohibited
clientrenewprohibited
clientdeleteprohibited

Domain Nameserver Information

Host IP Address Country
ns1.seaborneairlines.com 107.180.71.200 United States of America United States of America
ns2.seaborneairlines.com 107.180.71.200 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
seaborneairlines.com A 3596 IP: 107.180.71.200
seaborneairlines.com NS 86400 Target: ns2.seaborneairlines.com
seaborneairlines.com NS 86400 Target: ns1.seaborneairlines.com
seaborneairlines.com SOA 10800 MNAME: ns1.seaborneairlines.com
RNAME: info.s107-180-71-200.secureserver.net
Serial: 2019030405
Refresh: 3600
Retry: 1800
Expire: 1209600
Minimum TTL: 86400
seaborneairlines.com MX 3600 Target: seaborneairlines-com.mail.protection.outlook.com
seaborneairlines.com TXT 3600 TXT: MS=ms45745371
seaborneairlines.com TXT 3600 TXT: v=spf1 ip4:10.195.88.253
include:spf.protection.outlook.com -all
seaborneairlines.com TXT 3600 TXT: _globalsign-domain-verification=m--3tsOx
gwLFDaJZ7kiO9PN7xd0M-eO_wCzKRxKzjC
seaborneairlines.com TXT 3600 TXT: MS=ms37392720
seaborneairlines.com SRV 3600 Priority: 100
Target: sipfed.online.lync.com
Weight: 1
Port: 5061
seaborneairlines.com SRV 3600 Priority: 100
Target: sipdir.online.lync.com
Weight: 1
Port: 443

Similarly Ranked Websites

Index of /

- onlinemarketingreviewsandtips.com
1,528,854 $ 480.00

BoyneRewards

- boynerewards.com
1,528,854 $ 720.00

Home - Dark Knight News

- darkknightnews.com

The Dark Knight news is a fan based site dedicated to the iconic DC hero, Batman. Get the latest Batman news, Batman comic news & Dark Knight movie news!

1,528,855 $ 720.00

KiatNews.ID | Tajam Mengulas Fakta

- kiatnews.id

Tajam Mengulas Fakta

1,528,855 $ 960.00

Darshana Industries Pvt. Ltd. Pune

- darshanaindustries.com

Darshana Industries Pvt. Ltd.

1,528,856 $ 720.00

Full WHOIS Lookup

Domain Name: SEABORNEAIRLINES.COM
Registry Domain ID: 23253431_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2019-03-25T17:07:12Z
Creation Date: 2000-03-24T19:34:57Z
Registrar Registration Expiration Date: 2020-03-24T18:34:57Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited
Registrant Organization: Seaborne Airlines
Registrant State/Province: Puerto Rico
Registrant Country: PR
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=SEABORNEAIRLINES.COM
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=SEABORNEAIRLINES.COM
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=SEABORNEAIRLINES.COM
Name Server: NS1.SEABORNEAIRLINES.COM
Name Server: NS2.SEABORNEAIRLINES.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-12-13T01:00:00Z <<<

For more information on Whois status codes, please visit https://www.icann.org/resources/pages/epp-status-codes-2014-06-16-en

Notes:

IMPORTANT: Port43 will provide the ICANN-required minimum data set per
ICANN Temporary Specification, adopted 17 May 2018.
Visit https://whois.godaddy.com to look up contact data for domains
not covered by GDPR policy.

The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.

Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.